Protein Info for MIT1002_03162 in Alteromonas macleodii MIT1002

Annotation: Iron-sulfur cluster insertion protein ErpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF01521: Fe-S_biosyn" amino acids 9 to 109 (101 residues), 71.8 bits, see alignment E=2.7e-24 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 9 to 114 (106 residues), 127.2 bits, see alignment E=1.4e-41

Best Hits

Swiss-Prot: 97% identical to ERPA_ALTMD: Iron-sulfur cluster insertion protein ErpA (erpA) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: None (inferred from 97% identity to amc:MADE_01609)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>MIT1002_03162 Iron-sulfur cluster insertion protein ErpA (Alteromonas macleodii MIT1002)
MSVETALPIEFSDAAAAKVKALVSEEENPDLKLRVYVTGGGCSGFQYGFTFDEKVNEGDM
TIEKDSVTMVVDPMSLQYLVGGIVDYVDGLEGSRFLVQNPNATTTCGCGASFSV