Protein Info for MIT1002_03154 in Alteromonas macleodii MIT1002

Annotation: Na+/H+ antiporter, NhaD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 47 (18 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 105 to 121 (17 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 147 to 174 (28 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 279 to 312 (34 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 352 to 376 (25 residues), see Phobius details amino acids 390 to 414 (25 residues), see Phobius details PF03600: CitMHS" amino acids 7 to 360 (354 residues), 82.9 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: None (inferred from 69% identity to alt:ambt_12280)

Predicted SEED Role

"Na+/H+ antiporter NhaD type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>MIT1002_03154 Na+/H+ antiporter, NhaD family (Alteromonas macleodii MIT1002)
MLDYVLIGIAVMALLGVVFEEVLHVNKAKTTLFFGTFAWILLFIDANRGPHLAELNEHLI
ENISEISTLWLFLVAAMTFVAYLNRKGMIENMLNIIMPQKITLKKLIFFTAIFSFCFSSL
ADNITATLVSIAMVLSLGLPFNQTMRFAVLVVFAVNSGGVSLITGDVTTLMIFLDDKVTI
TQLLLLIIPSLTAVLFLALLLSIGMKGEVKIKKTRHELRPVDYVIAGIFLSTIVLTLIAN
VLFAIPPMLSFLAGMAVMFLVATFMGEEKYDDPILDYIRLIEFDTLLFFLGVLLLVGMLD
HIDALGALLHVYSVMPTTGANFVMGVLSSMIDNVPLTAALLKADIAMSTAEWMAFTYAVG
VGGSLLIIGSSAGIVTMSKVKGLTFAKYGKFVLLLLAAYSVGYALVLVMANMFVTAS