Protein Info for MIT1002_03144 in Alteromonas macleodii MIT1002

Annotation: adenosylcobinamide-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details amino acids 246 to 265 (20 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details PF03186: CobD_Cbib" amino acids 16 to 286 (271 residues), 94.8 bits, see alignment E=2.9e-31

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 86% identity to amc:MADE_01626)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>MIT1002_03144 adenosylcobinamide-phosphate synthase (Alteromonas macleodii MIT1002)
MAEVISDPQYQSLFVLWLAIAVDALWRWPQSTHPLTLMRYLVQQMGRKVVPSREYGRSQH
YISGSLAALVLLAPLVVCVAILVYMAQYPVFFEAIILVALLDYGYQRQQYKKVLASVGRN
KKSLAREMAQTITARQCDSLSDIGIAKAAIESLWLKFLYLYCGVIFYFVVAGPIGALIYR
LLLLTSWQWHYRTPAMTFFAKPVRNLVYLLNMPPAVIGGLATLLVSHPIKGFRAIKRSPV
KDKTSLLLALMGGVLDIKLGGPAIYANKKIRYTRVGGANEVKYSHMLTAKNTVTHAMIAV
SAFASLAMLAMAVAQ