Protein Info for MIT1002_03113 in Alteromonas macleodii MIT1002

Annotation: Ribosomal RNA small subunit methyltransferase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF00590: TP_methylase" amino acids 6 to 204 (199 residues), 113.8 bits, see alignment E=1.1e-36 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 7 to 274 (268 residues), 285.4 bits, see alignment E=2.3e-89 PF23016: RsmI_C" amino acids 233 to 276 (44 residues), 53.9 bits, see alignment 1.3e-18

Best Hits

Swiss-Prot: 51% identical to RSMI_VIBCH: Ribosomal RNA small subunit methyltransferase I (rsmI) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07056, (no description) (inferred from 91% identity to amc:MADE_03354)

MetaCyc: 50% identical to 16S rRNA 2'-O-ribose C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11637 [EC: 2.1.1.198]

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.198

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>MIT1002_03113 Ribosomal RNA small subunit methyltransferase I (Alteromonas macleodii MIT1002)
MTDTATLYIVPTPIGNLDDISARAIRVLSEVSWIAAEDTRHSARLLQHFSIGTKTLSLHE
HNEDKRTAMLCERLKGGESVALISDAGTPLISDPGFVLVRKCREQGIPVSALPGPCAAIT
ALSASGLPTDKFIFEGFLPVKVQARESVLSALIDRTFTTVYYEAPRRILDTVTDIQRVLG
DRQIVVAKELSKTFETYVSGSAQDVIDYLNADVAHQKGEFVVMIGPAKVSDQAIPSEAMS
LLSVLCEHMPLKKAAAVVATHYDLKKNALYQAGLDAKA