Protein Info for MIT1002_03109 in Alteromonas macleodii MIT1002

Annotation: Saccharopine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03435: Sacchrp_dh_NADP" amino acids 4 to 135 (132 residues), 110.8 bits, see alignment E=6e-36 PF16653: Sacchrp_dh_C" amino acids 139 to 386 (248 residues), 146.3 bits, see alignment E=1.7e-46

Best Hits

KEGG orthology group: K00290, saccharopine dehydrogenase (NAD+, L-lysine forming) [EC: 1.5.1.7] (inferred from 98% identity to amc:MADE_03351)

MetaCyc: 58% identical to carboxyspermidine dehydrogenase (Campylobacter jejuni jejuni 81116)
RXN-11566 [EC: 1.5.1.43]

Predicted SEED Role

"Carboxynorspermidine dehydrogenase, putative (EC 1.1.1.-)" in subsystem Polyamine Metabolism (EC 1.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.5.1.43 or 1.5.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>MIT1002_03109 Saccharopine dehydrogenase (Alteromonas macleodii MIT1002)
MSRVLIIGAGGVASVTVKKCARLPQHFDEIYLASRTVSKCEALQQEVGADRVKGVFAVDA
DNAKEVEALINEVKPDLVINLALPYQDLPIMDACLATNTDYLDTANYEPKDEAKFEYSWQ
WAYQDKFKDAGIMALLGSGFDPGVTNVYTAYAAKHYFDEIHYLDIVDCNGGDHGQAFATN
FNPEINIREITQRGRYWENGEWKETDPLSVREDLDYQNIGVRASYLMFHEELESIVKHFP
TLKRARFWMTFGDAYLNHLRVLEGIGMTSIEPVEFQGQKIVPLEFLKAVLPNPGSLAEGY
SGMTCIGTYITGIKDGKEKTIFIYNNCDHAKCNEEVGAQAVSYTTGVPAMIGAALMLNGT
WKEAGVWNMEQFDPDPFMDMLNEHGLPWHVLECEGSPFTK