Protein Info for MIT1002_03109 in Alteromonas macleodii MIT1002

Annotation: Saccharopine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03435: Sacchrp_dh_NADP
  • amino acids 4 to 135 (132 residues), 111 bits, E=5.4e-36
• PF16653: Sacchrp_dh_C
  • amino acids 139 to 386 (248 residues), 160.1 bits, E=1.2e-50

Best Hits

KEGG orthology group: K00290, saccharopine dehydrogenase (NAD+, L-lysine forming) [EC: 1.5.1.7] (inferred from 98% identity to amc:MADE_03351)

MetaCyc: 58% identical to carboxyspermidine dehydrogenase (Campylobacter jejuni jejuni 81116)
RXN-11566 [EC: 1.5.1.43]

Predicted SEED Role

"Carboxynorspermidine dehydrogenase, putative (EC 1.1.1.-)" in subsystem Polyamine Metabolism (EC 1.1.1.-)

MetaCyc Pathways

• spermidine biosynthesis II (3/4 steps found)
• norspermidine biosynthesis (2/6 steps found)
• superpathway of polyamine biosynthesis III (3/8 steps found)
• L-lysine biosynthesis IV (3/9 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Lysine biosynthesis
• Lysine degradation
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.- or 1.5.1.43 or 1.5.1.7

Protein Sequence (400 amino acids)

>MIT1002_03109 Saccharopine dehydrogenase (Alteromonas macleodii MIT1002)
MSRVLIIGAGGVASVTVKKCARLPQHFDEIYLASRTVSKCEALQQEVGADRVKGVFAVDA
DNAKEVEALINEVKPDLVINLALPYQDLPIMDACLATNTDYLDTANYEPKDEAKFEYSWQ
WAYQDKFKDAGIMALLGSGFDPGVTNVYTAYAAKHYFDEIHYLDIVDCNGGDHGQAFATN
FNPEINIREITQRGRYWENGEWKETDPLSVREDLDYQNIGVRASYLMFHEELESIVKHFP
TLKRARFWMTFGDAYLNHLRVLEGIGMTSIEPVEFQGQKIVPLEFLKAVLPNPGSLAEGY
SGMTCIGTYITGIKDGKEKTIFIYNNCDHAKCNEEVGAQAVSYTTGVPAMIGAALMLNGT
WKEAGVWNMEQFDPDPFMDMLNEHGLPWHVLECEGSPFTK