Protein Info for MIT1002_03084 in Alteromonas macleodii MIT1002

Annotation: Threonine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14821: Thr_synth_N
  • amino acids 8 to 78 (71 residues), 43.8 bits, E=3.5e-15
• TIGR00260: threonine synthase
  • amino acids 55 to 391 (337 residues), 366.7 bits, E=5.9e-114
• PF00291: PALP
  • amino acids 85 to 366 (282 residues), 92.1 bits, E=6.2e-30

Best Hits

Swiss-Prot: 64% identical to THRC_HAEIN: Threonine synthase (thrC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01733, threonine synthase [EC: 4.2.3.1] (inferred from 98% identity to amc:MADE_03326)

Predicted SEED Role

"Threonine synthase (EC 4.2.3.1)" in subsystem Threonine and Homoserine Biosynthesis (EC 4.2.3.1)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.1

Protein Sequence (427 amino acids)

>MIT1002_03084 Threonine synthase (Alteromonas macleodii MIT1002)
MELVNLKDSSDTANFAEAVKRGLGKNQGLYFPEHIPTLDNIDELLEKPFVERSIEVLRAL
IGDELNNGELEEIVQTAFAFGAPVEQVNDNVYCLELFHGPTLAFKDFGGRFMAQTLSRIS
EGKPVTILTATSGDTGAAVAHAFHGIDNINVVILFPKGKISALQEKLFTTLGGNIHTVAV
ESDFDACQSLVKTAFDDPDVREGLHLNSANSINISRLLAQVCYYFEAVSQLPKEKRDQLV
ISVPSGNFGNLTAGMIAKSLGLPIKRFIAATNLNDTVPRYLKTGEWEPKATVATMSNAMD
VSQPNNWPRIEALIERGYIDKACLKGEMVDEEYTQLAMRQLAQQGYTSEPHAAIAYRAVS
HDLEDGEIGLFLGTAHPAKFRETVENVLGNPISLPKALADVAGEDSLAVDLPASYEALKQ
HMMDLLK