Protein Info for MIT1002_03080 in Alteromonas macleodii MIT1002

Annotation: Transaldolase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00874: transaldolase
  • amino acids 3 to 317 (315 residues), 519.5 bits, E=1.7e-160
• PF00923: TAL_FSA
  • amino acids 14 to 312 (299 residues), 338.2 bits, E=2.1e-105

Best Hits

Swiss-Prot: 97% identical to TAL_ALTMD: Transaldolase (tal) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 97% identity to amc:MADE_03321)

MetaCyc: 70% identical to transaldolase B (Escherichia coli K-12 substr. MG1655)
Transaldolase. [EC: 2.2.1.2]

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

• pentose phosphate pathway (8/8 steps found)
• Rubisco shunt (9/10 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Protein Sequence (319 amino acids)

>MIT1002_03080 Transaldolase B (Alteromonas macleodii MIT1002)
MSNQLASLRDITTVVADTGDIDAIKKYQPVDATTNPSLLLKAAGLPQYASLIDDAVAWAK
LQSNDADQQLTDAADKLAVAIGKEISATIPGRISTEVDARLSFDTAATIEKAERLVQLYE
DAGIDKSRILIKIASTWEGIQAAEELEKKGIQCNLTLLFSFAQAQACAEAGVYLISPFVG
RILDWYKKATGTESYAPDEDPGVVSVTKIYNYYKDHGYNTVVMGASFRNIGEIQALAGCD
RLTISPALLEELANEPGDLEVKLKDNGATKTPGDRLTESEFRWAMNEDAMATEKLSEGIR
NFAADQEKLETMLREKLSA