Protein Info for MIT1002_03071 in Alteromonas macleodii MIT1002

Annotation: Peptide methionine sulfoxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 27 to 176 (150 residues), 129.9 bits, see alignment E=5.2e-42 PF01625: PMSR" amino acids 27 to 196 (170 residues), 179.6 bits, see alignment E=2.8e-57

Best Hits

Swiss-Prot: 44% identical to MSRA2_RHIME: Peptide methionine sulfoxide reductase MsrA 2 (msrA2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 77% identity to alt:ambt_05590)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>MIT1002_03071 Peptide methionine sulfoxide reductase MsrA (Alteromonas macleodii MIT1002)
MKLTLSAVFISTALSASFFTPSTSADEAILAGGCFWCMESDFEKLDGVTDVVSGFTGGSA
PNPTYNGNHKGHFEAVKITYDGDMLSYNDILDHFWVNIDPFDDRGQFCDKGPSYLSAIFV
ANDKERAIAEKTKADVVAQFPNKKVVTPILDASTFYPIKGDEIGHQDFYKKSPVRYKFYR
WNCGRDQRLEEIWGEKALGKNKS