Protein Info for MIT1002_03063 in Alteromonas macleodii MIT1002

Annotation: YGGT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 91 to 115 (25 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details PF02325: YGGT" amino acids 9 to 76 (68 residues), 64.2 bits, see alignment E=6.1e-22 amino acids 106 to 171 (66 residues), 75.6 bits, see alignment E=1.6e-25

Best Hits

Swiss-Prot: 43% identical to Y392_PSEAE: Uncharacterized protein PA0392 (PA0392) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02221, YggT family protein (inferred from 97% identity to amc:MADE_03300)

Predicted SEED Role

"Integral membrane protein YggT, involved in response to extracytoplasmic stress (osmotic shock)" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>MIT1002_03063 YGGT family protein (Alteromonas macleodii MIT1002)
MNATVFLVDTLFSLYLMVVILRLWLQMVQADFYNPLSQFVVKATHPIVGPLRRIIPSIGR
FDTATFVLAVAVCALKLITLGLMFGGSLNPVGIAILSVIGVIKETLSLMFWVLLLRAILS
WVSQGQSPVDYVLYQLTEPFLAPIRKVIPPLGGLDLSVLIAIIALQFLQLLIQDTFPM