Protein Info for MIT1002_03057 in Alteromonas macleodii MIT1002

Annotation: Putative Holliday junction resolvase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03652: RuvX
  • amino acids 8 to 137 (130 residues), 148.1 bits, E=1e-47
• TIGR00250: putative transcription antitermination factor YqgF
  • amino acids 10 to 138 (129 residues), 168.9 bits, E=2.6e-54

Best Hits

Swiss-Prot: 72% identical to YQGF_SHEDO: Putative pre-16S rRNA nuclease (Sden_2673) from Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 92% identity to amc:MADE_03294)

MetaCyc: 67% identical to ribonuclease H-like domain-containing nuclease (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Putative Holliday junction resolvase YqgF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.1

Use Curated BLAST to search for 3.1.-.- or 3.1.11.1

Protein Sequence (143 amino acids)

>MIT1002_03057 Putative Holliday junction resolvase (Alteromonas macleodii MIT1002)
MPDIGNRTVLAFDFGTKSIGVAVGQEITGTASPLAALKARDGIPDWTLIEKLYEEWQPHI
VVVGLPLNMDGTEQEMTQRARKFANRLHGRFKVAVDTCDERLTTTDAKAMLFELGGYKKL
TKDKVDSVSACVIFASWSESQYE