Protein Info for MIT1002_03053 in Alteromonas macleodii MIT1002

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 23 to 49 (27 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 24 to 60 (37 residues), 22.6 bits, see alignment 1.6e-08 PF21088: MS_channel_1st" amino acids 69 to 109 (41 residues), 29.8 bits, see alignment 9.3e-11 PF00924: MS_channel_2nd" amino acids 110 to 176 (67 residues), 76.5 bits, see alignment E=2.7e-25 PF21082: MS_channel_3rd" amino acids 183 to 265 (83 residues), 58.1 bits, see alignment E=1.9e-19

Best Hits

Swiss-Prot: 48% identical to MSCS_EDWI9: Small-conductance mechanosensitive channel (mscS) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 92% identity to amc:MADE_03290)

MetaCyc: 43% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>MIT1002_03053 Small-conductance mechanosensitive channel (Alteromonas macleodii MIT1002)
MEEKLSLFSASDVERYINDYAIPWGINILMAIAIYVIGRIVVGFILSVFRRLMAKSKYDN
MLVDFLEAILSAILMLFVIVASLDQLGVDTTSLVAILGAAGLAIGLSLQDSLKNFAAGVM
LLVFKPFKAGDFVEAAGTAGSIVKIGIFTTTMNTPDNKEIIVPNGNIYGGNITNYSARDT
RRVDMVVGIGYDADLLKAKRILEEMVAADERILAEPAPKIAVSELADSSVNFVVRPWVNS
ADFWGVKFDFTENVKLRFDEEGISIPFPQMDVHLHKADSE