Protein Info for MIT1002_03048 in Alteromonas macleodii MIT1002

Annotation: Transcriptional regulatory protein ZraR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF00072: Response_reg" amino acids 5 to 115 (111 residues), 64.5 bits, see alignment E=2.4e-21 TIGR02915: PEP-CTERM-box response regulator transcription factor" amino acids 5 to 446 (442 residues), 700.9 bits, see alignment E=3.3e-215 PF00158: Sigma54_activat" amino acids 143 to 309 (167 residues), 247.5 bits, see alignment E=1.5e-77 PF14532: Sigma54_activ_2" amino acids 144 to 314 (171 residues), 82 bits, see alignment E=1.3e-26 PF07728: AAA_5" amino acids 167 to 284 (118 residues), 22.2 bits, see alignment E=3.1e-08 PF02954: HTH_8" amino acids 405 to 444 (40 residues), 23.7 bits, see alignment 8.4e-09

Best Hits

KEGG orthology group: K02481, two-component system, NtrC family, response regulator (inferred from 97% identity to amc:MADE_03284)

Predicted SEED Role

"Response regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>MIT1002_03048 Transcriptional regulatory protein ZraR (Alteromonas macleodii MIT1002)
MTDTILVVDDDLGIQKQLKWSLTDYNVVFADDHTSAIAQLRRFEPKVVTLDLGLPPDPAN
ASEGLRILHDIIALAPRTKVIVVTGNNDKQHALKAIDFGAYDFYQKPIDSDTIKLLVHRA
LNLSKLEHENSILARTRSGMSRIVGNSEAIQKVVRRAEKIANTDISTLLLGESGTGKEVF
ARSIHEHSPRKDKPFVAINCASIPENLLESELFGYEKGAFTGANKTTVGKIETAQGGTLF
LDEIGDMPIGLQAKMLRFLQERVIERVGGRNEIPVDIRVICATHRDLQAMVAQETFREDL
YYRVGEMPIMIPPLRERDQDIILLARTFLNIYREEFKAKAKSFSETAVNAMLAHKWPGNI
REMQNKLKSAVIMAEGTVIQPDDLGLMPVDAHDEPETLNLREVREIAESRAIRRAYQKAD
KNMSKTAELLGVTRPTLYSLIDKYHMEDIKNSD