Protein Info for MIT1002_03023 in Alteromonas macleodii MIT1002

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 TIGR01205: D-alanine--D-alanine ligase" amino acids 21 to 318 (298 residues), 336.9 bits, see alignment E=5e-105 PF01820: Dala_Dala_lig_N" amino acids 70 to 103 (34 residues), 35.6 bits, see alignment 3e-12 PF02786: CPSase_L_D2" amino acids 113 to 287 (175 residues), 31.5 bits, see alignment E=3.2e-11 PF07478: Dala_Dala_lig_C" amino acids 120 to 316 (197 residues), 202.7 bits, see alignment E=1.2e-63 PF02222: ATP-grasp" amino acids 120 to 268 (149 residues), 31 bits, see alignment E=4.9e-11 PF13535: ATP-grasp_4" amino acids 154 to 286 (133 residues), 28.9 bits, see alignment E=2e-10

Best Hits

Swiss-Prot: 69% identical to DDL_PSEA6: D-alanine--D-alanine ligase (ddl) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 96% identity to amc:MADE_03256)

MetaCyc: 52% identical to D-alanine--D-alanine ligase B (Escherichia coli K-12 substr. MG1655)
D-alanine--D-alanine ligase. [EC: 6.3.2.4]

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>MIT1002_03023 D-alanine--D-alanine ligase (Alteromonas macleodii MIT1002)
MLTPSVSIHSQKTHSPNEYGKVAVLLGGDSAEREVSLNSGNAVLNALLRQGVDAFAFDPA
ERPLTDLIDLNVDRALIMLHGRGGEDGSMQGALQFLKIPYTGSRVLGSALAMDKIHTKQV
WQSLGLPTAKYEIADKRHFEAGKCSAIMDKLGNEVMVKPAREGSSIGMARVTSAKQLETA
IQDAFKYDNQVLLEQYIDGPEFTVSVLQGQALPSIRMSTPHTFYDYAAKYQDNTTEYYCP
SGLSEEQEAQLAKLASRAFDAISGSGWGRIDVMQDNQRQFYLLEANTVPGMTEKSLVPKA
AKVAGLTFDELVLSILSTSFDDVANKA