Protein Info for MIT1002_03016 in Alteromonas macleodii MIT1002

Annotation: 8-oxo-dGTP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00586: mutator mutT protein
  • amino acids 1 to 126 (126 residues), 124.7 bits, E=1.2e-40
• PF00293: NUDIX
  • amino acids 5 to 122 (118 residues), 70.1 bits, E=1.9e-23
• PF14815: NUDIX_4
  • amino acids 7 to 123 (117 residues), 79.8 bits, E=1.3e-26

Best Hits

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 90% identity to amc:MADE_03249)

Predicted SEED Role

"Mutator mutT protein (7,8-dihydro-8-oxoguanine-triphosphatase) (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Protein Sequence (127 amino acids)

>MIT1002_03016 8-oxo-dGTP diphosphatase (Alteromonas macleodii MIT1002)
MKVVHVAVGVIARGDEIFITLRPDNVHQGGKWEFPGGKVEEGETVLQALKRELAEEVGII
VNRSEPVIVITHDYGDKQVKLDVHRVCDFTGEPHGKEGQQSRWVKVTSLNASDFPEANIP
IISALQK