Protein Info for MIT1002_03006 in Alteromonas macleodii MIT1002

Annotation: 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01510: Amidase_2
  • amino acids 22 to 163 (142 residues), 102.3 bits, E=1.3e-33

Best Hits

Swiss-Prot: 63% identical to AMPD_SALTS: 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (ampD) from Salmonella typhimurium (strain SL1344)

KEGG orthology group: K03806, AmpD protein (inferred from 88% identity to amc:MADE_03228)

MetaCyc: 62% identical to 1,6-anhydro-N-acetylmuramoyl-L-alanine amidase (Escherichia coli K-12 substr. MG1655)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) AmpD" (EC 3.5.1.28)

MetaCyc Pathways

• peptidoglycan recycling I (10/14 steps found)
• peptidoglycan recycling II (3/10 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Protein Sequence (179 amino acids)

>MIT1002_03006 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (Alteromonas macleodii MIT1002)
MALYNEAKYTASPHYDARPDSTDVSLLVIHNISLPPSQFGTPGIRQLFTGTLNPDEHPFY
KEIAGLRVSAHCVIYRTGEVEQFVPFEQRAWHAGLSSFQGRSRCNDYAIGIELEGTDTLP
YTDAQYRTLGELTDFITRYYPRITLGRIVGHNDIAPGRKTDPGAAFDWARYRMRVAGFK