Protein Info for MIT1002_02991 in Alteromonas macleodii MIT1002

Annotation: putative 5-formyltetrahydrofolate cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 TIGR02727: 5-formyltetrahydrofolate cyclo-ligase" amino acids 55 to 248 (194 residues), 152.2 bits, see alignment E=7.5e-49 PF01812: 5-FTHF_cyc-lig" amino acids 56 to 248 (193 residues), 130 bits, see alignment E=5.3e-42

Best Hits

Predicted SEED Role

"5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>MIT1002_02991 putative 5-formyltetrahydrofolate cyclo-ligase (Alteromonas macleodii MIT1002)
MSPSSSGSGTFRSLASNKVNSTETASAPALAMKPTQIAPSQTIQTSVSNEDIQARAQLRK
KLREARRGLTNQQHTDAAKRIASRLRTLPFLDNSTTIAGYLVNDGEVNLTYFIESIWQSS
HDKEFALPVLHPVCKGHLLFLSYTQHSQLVKNKYNIEEPVLSCENVVPVRQCDVILMPLV
GFDVNGNRLGMGGGYYDRTLSFTQRAPDSHSFSVSKMPKLVGIAHDIQEVDALPVAPWDV
PLDAIVTPSRTLQFTKP