Protein Info for MIT1002_02965 in Alteromonas macleodii MIT1002

Annotation: Phytochrome-like protein cph1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 884 PF08446: PAS_2" amino acids 13 to 125 (113 residues), 39.6 bits, see alignment E=2.2e-13 PF01590: GAF" amino acids 155 to 295 (141 residues), 34 bits, see alignment E=1.2e-11 PF00360: PHY" amino acids 339 to 504 (166 residues), 90.8 bits, see alignment E=2.1e-29 PF00512: HisKA" amino acids 528 to 592 (65 residues), 57 bits, see alignment 4.9e-19 PF02518: HATPase_c" amino acids 638 to 749 (112 residues), 88 bits, see alignment E=1.7e-28 PF00072: Response_reg" amino acids 772 to 882 (111 residues), 51.5 bits, see alignment E=3.3e-17

Best Hits

KEGG orthology group: None (inferred from 91% identity to amc:MADE_00897)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (884 amino acids)

>MIT1002_02965 Phytochrome-like protein cph1 (Alteromonas macleodii MIT1002)
MTQSTQNFNFERCEDEPIHIPESVQSYGFLIAFNYEDLEVSIVSENCNTIFADEIIGKGF
LDILSSDTDERAFLEETFDRVSKSKIRLPIKLHLKASLLKEGAAIDYLAVVYDSGCHYVV
ELEPATEFRDTYSAEQFVKLYSMSIAPRFKEMTSLKEMAQEMVSTIRYLTNMDRVVLYKF
NKDYSGKVIAEAKSEDMESYQDLYFPASDIPKQARELYKTNWVRLTPDTELPASRLIPSV
EESERERLDLTRSLLRTFSPIHLQYIRNQGLRASFSISLVTDGELYGLISCHHREACYIP
QNVRLQCENLSQLFSWHLLAKEEEIAKRKKHVTDKAVDAMLDRIGPANPISRVVKSGERA
FLDALNSSGFVYYSQYETITLGSTLPVEVIKDIFSKASSEGGFPYTNDSLYHDYPEAREH
GIAGIMIIPLFEKKQYFTAWFRKETHRNQKWIGAKDEKSEDAPKGERLKPRSSFTIHTRT
IKGRSTAFDKTDVDTANRLNRMFLVYALDVQERMHISIQELEKQDNYRNEFLATLAHELR
NPLGPIMSGASILETVDDEKTRKRVTAIINRQAEYMSKLINDLMDVSRITRGKVKLEFER
LKIQDVLSDSLEIVEQQVKAKKHDITVNCLEEDVTVYGDKARLSQIFSNIIHNATKYTKE
SGKIVVEIRKDGVMIVVAVKDNGMGIPEDRLKDVFNMFTQIEAHSTHTKGGLGIGLTLVS
KLVALHHGEVSVMSEGVDRGSTFEVRLPISKTAYEQSENQKLDPVIQSRSKVMFVDDNAD
LIDAYCLLAESMGVTALGITSPKEAVDAFKTFKPHSVFLDIGMPDIDGYQLVKMLKALPE
SENVKFYSQSGWGSEKYVEDSQAAGFDQHFVKPLSKDTIQSVLS