Protein Info for MIT1002_02955 in Alteromonas macleodii MIT1002

Annotation: Sugar efflux transporter A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 342 to 359 (18 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 294 (281 residues), 79.2 bits, see alignment E=1.4e-26 amino acids 214 to 385 (172 residues), 47.5 bits, see alignment E=6.5e-17

Best Hits

KEGG orthology group: K03291, MFS transporter, SET family, sugar efflux transporter (inferred from 91% identity to amc:MADE_00906)

Predicted SEED Role

"Sugar efflux transporter B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>MIT1002_02955 Sugar efflux transporter A (Alteromonas macleodii MIT1002)
MSSRHAFSPQLPFLLLSLLTGLTSSFVTPLMSYFLVDEINVEPIYISIYMVSVTLSGLVI
SQYLGHLAGKGFNANRLYGLTMICVGIAMVAFIFSKQFWHVFLAGVLFMSVGAGAVSQML
TVSGLWAKNQDIDLAAFNSKVRAAISLAWVVGPPLAFTLVANFGFAASFSVAIACVIVAT
LFVVNIVPPQKANQQSLNTTLKGSLSLPFWLVGLAILAGMAGNVMYLSSMPLYVMNELGL
PENLPGLMMGVVAALEIPTMLLAAKLARRFPPAGIMAVAFIFGCCFYVGVYFSQSSWELL
TLQILNALFYGLYAGIGLTLLQQQAPDLTGFTSAFYSNATRVGMMLGTIGAGTVAQFFSF
RDATIGSLCIAIFGLNVMLVFMYVKHRAAR