Protein Info for MIT1002_02942 in Alteromonas macleodii MIT1002

Annotation: putative MFS-type transporter YcaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 343 (326 residues), 83.9 bits, see alignment E=1.6e-27 PF06779: MFS_4" amino acids 32 to 348 (317 residues), 33.1 bits, see alignment E=5.9e-12 PF00083: Sugar_tr" amino acids 44 to 120 (77 residues), 22.8 bits, see alignment E=6.1e-09

Best Hits

KEGG orthology group: None (inferred from 66% identity to vch:VCA0753)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>MIT1002_02942 putative MFS-type transporter YcaD (Alteromonas macleodii MIT1002)
MDNTLIPPAKARVSVPVIALGMYAVASGYLMSLIPLMLSHYNLDTAIASWLASSFYAGLL
VGALSIEPLVTRVGYKHGFALCLGILVLTIAVMPLFAHTAVWLVARLVAGVAVAGVFVIV
ESWLLHGDEADRAKRLGLYMGALYGGSSLGQLGIGAIGVGGMLPFAAIFTILILAIGVLL
FAKSEQPEASHSTPLSLKQISKLNHAAIIGCIVSGLTLGAIYGLMPLELLNRGIAHDDLG
SLMALIILGAMAVQPLIPALSKYLGRTLLMALFCLLGVAAITLTAAVSGIYALGAGLFLL
GMAIFALYPVAINLACDKLDASFIVCATQVMLFSYSVGSVVGPLIADNFLVGPQGLMGYL
FACLLATSIYMLIASVKTKGRAMAGE