Protein Info for MIT1002_02941 in Alteromonas macleodii MIT1002

Annotation: ribonuclease BN/unknown domain fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 38 to 65 (28 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 25 to 284 (260 residues), 108.5 bits, see alignment E=2.5e-35 PF03631: Virul_fac_BrkB" amino acids 32 to 285 (254 residues), 214.2 bits, see alignment E=1.3e-67

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 86% identity to amc:MADE_00917)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>MIT1002_02941 ribonuclease BN/unknown domain fusion protein (Alteromonas macleodii MIT1002)
MSKERFNHAKSAFELSLKSWWSISKRIFTSLQKDNIPLISAGVAFYCLLAIFPLLGATIA
LYGLVVSPDELQRHMALLVNVVPNDSRYIIEEQLKNLTEKSNTALGWSFLFTLLLSLWSS
SKGANALIKACNITYSEAEGRGFFKGILARITCTIFMILTVIVSLACITILPEAINWMTS
NALSTEQAMWVTWPVMLALFNIALSALYRYAPHRREAQWRWVTPGSVFATLLWVVASYGF
SIYLNEFGSYNKTYGSVGGIIILLMWLYLTAYIILIGAEVNSSIELQTSADSTVGEDKPM
GERNAFVADHTPDDLRR