Protein Info for MIT1002_02929 in Alteromonas macleodii MIT1002

Annotation: Lactoylglutathione lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR00068: lactoylglutathione lyase" amino acids 13 to 174 (162 residues), 163 bits, see alignment E=1.7e-52 PF00903: Glyoxalase" amino acids 24 to 166 (143 residues), 79.8 bits, see alignment E=2.2e-26

Best Hits

Swiss-Prot: 60% identical to LGUL_ARATH: Lactoylglutathione lyase (At1g08110) from Arabidopsis thaliana

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 90% identity to amc:MADE_00930)

MetaCyc: 57% identical to glyoxalase I monomer (Pseudomonas putida)
Lactoylglutathione lyase. [EC: 4.4.1.5]

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>MIT1002_02929 Lactoylglutathione lyase (Alteromonas macleodii MIT1002)
MSRHFDKAEGLYEEKDAATQGFVFNQTMLRIADPKRSLDFYTRVMGMTLIKRLDFEEMKF
SLYFLAAGDDFSDISDDVDERTQQTFGRPAMLELTHNWGDTPETVDYHNGNTEPKGFGHI
GFHVPDAEAACARFASLDVPFQKGLNDGSMKGIAFIKDPDGYWIEIFNASNVSATCAPHL
KK