Protein Info for MIT1002_02912 in Alteromonas macleodii MIT1002

Annotation: Ribosomal RNA large subunit methyltransferase F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF05971: Methyltransf_10" amino acids 1 to 329 (329 residues), 367 bits, see alignment E=4e-114

Best Hits

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase F (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.51

Use Curated BLAST to search for 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>MIT1002_02912 Ribosomal RNA large subunit methyltransferase F (Alteromonas macleodii MIT1002)
MHPKNLHKNGYPMDTLCQTYPALKSFLVRAKSGNTSIDFTSPKAVKVLNAALLHHYYRLE
YWDIPDGYLCPPVPGRADYIHGIADLLKSTSSSAQGEQSQQGKDQNVRGLDIGVGANAIY
PIIGVTTYDWSFVGSDVDDVAVKSAKAIASKNSVLAHKFQVRKQLNRASIFNGVIKENER
FTFTMCNPPFQKSAQEALSGTRRKTSNLTRNKQKRSGAKLTDNREQGFEHRTSKLQGKNA
AYQGKDANLNFAGQANELWCEGGELAFIQRMVKESVSVKDNVEWFTCLVSKSAHLKPIKT
SIDYYGAAQCKVIDMGQGSKLSRFVAWTF