Protein Info for MIT1002_02910 in Alteromonas macleodii MIT1002

Annotation: BCCT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 36 to 57 (22 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 334 to 352 (19 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 96% identity to amc:MADE_02643)

Predicted SEED Role

"Choline transporter BetT, short form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>MIT1002_02910 BCCT family transporter (Alteromonas macleodii MIT1002)
MTVWLSAGIIFTLLSVAYILFKWGNMKVVGVTPVRTFTFIAILFTSGLDVGLIMFPLTEF
AGYADISASPEYAFTNPLAIEFGFWGFLIWGFYFLTCFYFCVIEPKVKFFELPVVKFVNN
VVIIGTCAFTAFLLLSNLPWYLPSIGDGESVVPAFYLIVFAAIAFAVYSSTSIKYVRILS
LTTTWVFIALIIGMWAAAFVFGESEITAYFTNLGLIGGYFANIDNFVLPINEYHEFYLFW
WFSWSIMIGQFTSRFVGGLKTYQVMLAMMVIPSIPIAAWFSVLYHYHSAGIPTEGITNLA
MVCVGVVFVINSLDSLIRLYTDNLNMTVERIGKGNYIALNIVALSLLTLLFKLDFLQIQW
VGALVITIFFSCFAFILSQKFKSVTAIKTSPKENKIDFTKIENLN