Protein Info for MIT1002_02902 in Alteromonas macleodii MIT1002

Annotation: Arginine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03709: OKR_DC_1_N
  • amino acids 38 to 148 (111 residues), 30.3 bits, E=1.7e-10
• PF01276: OKR_DC_1
  • amino acids 185 to 562 (378 residues), 295.6 bits, E=2.3e-91
• PF00266: Aminotran_5
  • amino acids 249 to 415 (167 residues), 30.7 bits, E=6.7e-11
• PF01212: Beta_elim_lyase
  • amino acids 251 to 412 (162 residues), 37 bits, E=1e-12
• PF01041: DegT_DnrJ_EryC1
  • amino acids 257 to 382 (126 residues), 29.5 bits, E=1.8e-10
• PF01053: Cys_Met_Meta_PP
  • amino acids 257 to 415 (159 residues), 29.4 bits, E=1.3e-10
• PF00155: Aminotran_1_2
  • amino acids 265 to 383 (119 residues), 20.9 bits, E=7.3e-08
• PF03711: OKR_DC_1_C
  • amino acids 612 to 659 (48 residues), 38.2 bits, 7e-13

Best Hits

KEGG orthology group: None (inferred from 71% identity to kko:Kkor_2346)

Predicted SEED Role

"Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19)" (EC 4.1.1.19)

MetaCyc Pathways

• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (3/3 steps found)
• putrescine biosynthesis II (3/3 steps found)
• arginine dependent acid resistance (1/1 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (1/2 steps found)
• putrescine biosynthesis I (1/2 steps found)
• spermidine biosynthesis III (1/4 steps found)
• superpathway of putrescine biosynthesis (1/4 steps found)
• superpathway of polyamine biosynthesis II (3/8 steps found)
• superpathway of arginine and polyamine biosynthesis (9/17 steps found)
• superpathway of polyamine biosynthesis I (1/8 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (3/11 steps found)
• superpathway of L-arginine and L-ornithine degradation (4/13 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.19

Use Curated BLAST to search for 4.1.1.19

Protein Sequence (677 amino acids)

>MIT1002_02902 Arginine decarboxylase (Alteromonas macleodii MIT1002)
MRPHLKILVIEDAVDLLEQITSSIGNTITYFDRSDVEISLLEANSVAKALQFVREDGDIQ
AVVFSWDVVAKVKELTDVVPLNGVLNENTSPAAESASSQNANEKTTGEKSSARNALIDNN
ARVIDAIKRIRPELPVYVLGDAVKGLDIVNQANGIESFFYRNDIISDPESILGYIINDFD
DRNETPFWTEYKDYVVESNDSWHTPGHSGGASFRNSPYISDFYRFFGRNVFVSDLSVSVD
SLGSLSDGTHAIGKAQAAVANTFEVRHSYFVTNGSSTSNKIILQTLLREGDKVIADRNCH
KSVHYGIIQARAMPVYLDSVFNPEYGIFSPPRMAQIKQLIEENTDAKLIVLTGCTYDGLL
TDLKQVVNLAHEHGIKVFIDEAWFAYSLFHPALRDYSAIAAGADYITHSAHKVVSAFSQA
SFIHVNDPDFDKDFFKEVFAIHTSTSPKYQLIASLDVCRQQLEMEGYKILNELLSNVAEL
KSQMAKFKRLKILSPSDFANMFSHFESDNIGHDPLKILIDVSALDYSNQEIHRFLMDEVG
LEIEKFTHSTILVLLTLGGMRSKIVRLYNALKRLDDGAVNLSKRKSKSPLPADIPPIHLD
DLPSKAFFSPREAIPWQNSVGRTAAGLITPYPPGIPLIVPGQKVEQAHIDYLQALASQKL
TVQGIYDGEIYVVADQQ