Protein Info for MIT1002_02861 in Alteromonas macleodii MIT1002

Annotation: putative O-glycosylation ligase, exosortase A-associated

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 70 (21 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 221 to 237 (17 residues), see Phobius details amino acids 249 to 265 (17 residues), see Phobius details amino acids 341 to 364 (24 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details amino acids 410 to 427 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 206 to 357 (152 residues), 68.1 bits, see alignment E=3.8e-23

Best Hits

KEGG orthology group: None (inferred from 49% identity to gag:Glaag_3222)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>MIT1002_02861 putative O-glycosylation ligase, exosortase A-associated (Alteromonas macleodii MIT1002)
MLSVLMFFATLLGGVILSLRHSIAIAFVVYQAIYFFNPEKRWWGNIVPDISYSFFIVIFM
ALLVLANSKLTKENKISKAPPLKWSIVVMLTYCVAYFYAIAPEYHYTFMIYFIKLIVIMC
LAYKLISSAKDFTYVLYGYIFSAWYVSFYVFQIGRNAGNRVEGVGLVDSPDANGLAAAIA
PALVLTLYYYWISKKYWMKGMFAIAGLFIANAVVLINSRGAFLAVAASIAFFMYFMYTSS
FQRKHQKKMAVFITIAGLSGALYIADDDFISRITGITGEVDKAEKQESGATRLVFWQAAW
EMAKDYPYGNGYRGFDYLSPLYIPEGIDTGRKRSRSVHSTWFETLTEVGYLGLLFFILML
WSAWKHLNKVKSYLRDNQLVDEYFKIIALQGSLIAFVIAMTFLNRMRAEILYWLIMFSAA
AYNVYVLKKYAGQPNSQNNT