Protein Info for MIT1002_02820 in Alteromonas macleodii MIT1002

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details PF03994: DUF350" amino acids 17 to 70 (54 residues), 45.4 bits, see alignment E=3.5e-16 amino acids 83 to 136 (54 residues), 52.3 bits, see alignment E=2.5e-18

Best Hits

Swiss-Prot: 39% identical to YJFL_ECOLI: UPF0719 inner membrane protein YjfL (yjfL) from Escherichia coli (strain K12)

KEGG orthology group: K08989, putative membrane protein (inferred from 98% identity to amc:MADE_01337)

Predicted SEED Role

"Membrane protein with DUF350 domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>MIT1002_02820 putative membrane protein (Alteromonas macleodii MIT1002)
MDTIMQSLAGLDNFALYFGLSIVFLFIFKLVYALVTPHDEWKLVKEEKNVAAAIGFGGAI
IGFAIALGSAASNSVAVVDFAIWALVAVIAQSLAFAILRFSFMPKIAERINNNEVSAGVM
LASMSIAVGLLNAACMTY