Protein Info for MIT1002_02818 in Alteromonas macleodii MIT1002

Annotation: Streptomyces lividans K+ channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 68 (17 residues), see Phobius details amino acids 78 to 104 (27 residues), see Phobius details PF07885: Ion_trans_2" amino acids 29 to 102 (74 residues), 46 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: None (inferred from 94% identity to amc:MADE_01339)

Predicted SEED Role

"Putative potassium channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>MIT1002_02818 Streptomyces lividans K+ channel (Alteromonas macleodii MIT1002)
MSPWIKLRKIMLQYFAESRWYTIVGATAFYAVTSYWLLYAAEEHDLITNADFIYWLAVTA
STVGYGDLSPVTPAGKLVVALYVIPLGLSIFAMVIGRIAAWVSLTWKKGLLGMNSLMLDE
HILVIGWNEQRTMLLLDLILQERDAMPERPDIVLCVKADITNPMPGVIEFVKVDSFNKDE
DMDRACVSTARTILIDNPQDDVTMTTALYCTKRNPDAHQVAYFDDDSLVSLLQDHCPKVE
CTPSVAIEMLVKAAFDPGSSMLHHDLLSIEEGQAQFSVKIPESSHAISVAKLFINLKRKH
DAIFIGYAPNGLVKEMVVNPPLDVTLNPGDTLFYIAERRINAINWSSLDAD