Protein Info for MIT1002_02813 in Alteromonas macleodii MIT1002

Annotation: Queuine tRNA-ribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 TIGR00430: tRNA-guanine transglycosylase" amino acids 3 to 365 (363 residues), 581.3 bits, see alignment E=7.8e-179 TIGR00449: tRNA-guanine family transglycosylase" amino acids 3 to 364 (362 residues), 557 bits, see alignment E=1.7e-171 PF01702: TGT" amino acids 12 to 362 (351 residues), 563.3 bits, see alignment E=1.1e-173

Best Hits

Swiss-Prot: 87% identical to TGT_PSEA6: Queuine tRNA-ribosyltransferase (tgt) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 94% identity to alt:ambt_03800)

MetaCyc: 76% identical to tRNA-guanine transglycosylase (Escherichia coli K-12 substr. MG1655)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>MIT1002_02813 Queuine tRNA-ribosyltransferase (Alteromonas macleodii MIT1002)
MQFELLKTEGRARRGRLVFERGVVETPAFMPVGTYGTVKGMTPEELKDSGAHICLGNTFH
LMLRPGTGIIRQHGDLHDFMNWDKPILTDSGGFQVFSLGDLRKITEEGVTFRSPINGEKI
LLTPEKSMEVQRDLGSDIVMIFDECTPYPATEQEARVSMEMSLRWAKRSKEAHGDNPAAL
FGIIQGGMYEGLRDVSLAGLEAIGFDGYAIGGLSVGEPKEDMIRIIDHTAPKIPEDKPRY
LMGVGKPEDLVESVRRGIDMFDCVMPTRNARNGHLFVTEGVVKIRNAKHRNDTSPLDENC
DCYTCKNYSRSYLHHLDKCNEILGARLNTIHNLRYYQRVMQGLRDAIDAGTLDEFVQEFY
EQKGLPVPAL