Protein Info for MIT1002_02811 in Alteromonas macleodii MIT1002

Annotation: preprotein translocase subunit SecD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 451 to 471 (21 residues), see Phobius details amino acids 477 to 497 (21 residues), see Phobius details amino acids 505 to 524 (20 residues), see Phobius details amino acids 546 to 570 (25 residues), see Phobius details amino acids 578 to 603 (26 residues), see Phobius details PF13721: SecD-TM1" amino acids 2 to 103 (102 residues), 104.3 bits, see alignment E=1.4e-33 PF07549: Sec_GG" amino acids 116 to 140 (25 residues), 27 bits, see alignment (E = 7.6e-10) TIGR01129: protein-export membrane protein SecD" amino acids 123 to 600 (478 residues), 497.5 bits, see alignment E=3.2e-153 PF21760: SecD_1st" amino acids 226 to 285 (60 residues), 101.1 bits, see alignment 5.3e-33 PF22599: SecDF_P1_head" amino acids 303 to 430 (128 residues), 115.9 bits, see alignment E=2.7e-37 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 344 to 593 (250 residues), 276 bits, see alignment E=2.5e-86 PF02355: SecD_SecF_C" amino acids 432 to 601 (170 residues), 74.4 bits, see alignment E=2.4e-24 PF03176: MMPL" amino acids 460 to 593 (134 residues), 30.1 bits, see alignment E=7.5e-11

Best Hits

Swiss-Prot: 60% identical to SECD_VIBAL: Protein translocase subunit SecD (secD) from Vibrio alginolyticus

KEGG orthology group: K03072, preprotein translocase subunit SecD (inferred from 97% identity to amc:MADE_01347)

MetaCyc: 56% identical to Sec translocon accessory complex subunit SecD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (614 amino acids)

>MIT1002_02811 preprotein translocase subunit SecD (Alteromonas macleodii MIT1002)
MLNKNSIWKVLSALIVVAMCALYALPNIYGEDHAVQISAGRDAVVTDATVEQVKAALSEK
NISPKRVEFENEQILVRVSDSDTQLVTRETLEKALGDDYYVAMNLAPDTPEWLEGLGGAP
MKLGLDLRGGVHFLMEVDMTEVIAKSLEDAEGGFRTSLREEGIRYRGVKQVDDHIDITFR
DEDALDKAEFFLRNQSRDLTFNQVDDLTLRAIFAESKLQEIRDNAVKQNITIIRNRVNQL
GVAEPLVQKQGADRIVVQLPGIQDTARAKEILNATATLEFRMVDQKNDIRDALNGRVPPG
SQVIEDQQGIPQLLEKRIMLTGSHIIDANSGVDEYGLPNVNISLDSEGGNKMSRSTRGNI
GKPMATVFIEYKSTGERNKDGKLVFEKHEQVISVATIRAQLGSKFQITGLDSPKEARDLA
LLLRAGALIAPIQIVEERTVGPSLGKENIELGMQAIMYGLAAVLVFMLIYYKAFGVVANI
ALITNLVMIVGIMSMIPGATLTLPGMAGIVLTVGMAVDANVLIFERIREEIRDGRSPQHA
IHQGYDSAFSTILDANITTFIAGLILFAVGTGPIKGFSITLMIGIATSMFTAILVTRVIV
NAVWGGRRVEKLAI