Protein Info for MIT1002_02799 in Alteromonas macleodii MIT1002

Annotation: putative ATP-dependent transporter SufC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01978: FeS assembly ATPase SufC
  • amino acids 2 to 242 (241 residues), 358.1 bits, E=1.1e-111
• PF00005: ABC_tran
  • amino acids 18 to 171 (154 residues), 73.7 bits, E=1.3e-24

Best Hits

Swiss-Prot: 63% identical to SUFC_ECOLI: Probable ATP-dependent transporter SufC (sufC) from Escherichia coli (strain K12)

KEGG orthology group: K09013, Fe-S cluster assembly ATP-binding protein (inferred from 98% identity to alt:ambt_03920)

Predicted SEED Role

"Iron-sulfur cluster assembly ATPase protein SufC"

Protein Sequence (253 amino acids)

>MIT1002_02799 putative ATP-dependent transporter SufC (Alteromonas macleodii MIT1002)
MLSIKNLHASVEEKNIIKGLNLEVKPGEVHAIMGPNGAGKSTLGYVLSGRDGYEVSEGEA
TLNGKDLLELEVEERAREGLFLAFQYPVEIPGVSNMEFMKESVNAMREQRGEAPLSAAEF
LKKAKEACKQVQLPLDFLKRGVNEGFSGGEKKRNEIMQMILLEPKLCILDESDSGLDVDA
LQVVADGVNSQRDGERSFIVVTHYQRLLDYIKPDFVHILADGKIVKSGDASLALEVEKSG
YAFLGKAYEEAEA