Protein Info for MIT1002_02796 in Alteromonas macleodii MIT1002

Annotation: Iron-sulfur cluster assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 13 to 117 (105 residues), 83.2 bits, see alignment E=6.6e-28 PF01521: Fe-S_biosyn" amino acids 13 to 113 (101 residues), 55.5 bits, see alignment E=3.1e-19

Best Hits

Swiss-Prot: 43% identical to ISCA_ENT38: Iron-binding protein IscA (iscA) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 95% identity to amc:MADE_01361)

Predicted SEED Role

"Iron binding protein SufA for iron-sulfur cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (118 amino acids)

>MIT1002_02796 Iron-sulfur cluster assembly protein (Alteromonas macleodii MIT1002)
MSVETFVPSTKLISLTDSAVKHFESKLKDKPGQLIRLSTKVSGCTGYAYVLDFADSAQAD
DEIVEISPVLNVAVAADATDLLRNTEIDYVTEGVNGVIKYNNPNVVDECGCGESFNVG