Protein Info for MIT1002_02790 in Alteromonas macleodii MIT1002

Annotation: photosystem I assembly protein Ycf3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 15 to 245 (231 residues), 213.7 bits, see alignment E=1.4e-67 PF13181: TPR_8" amino acids 43 to 73 (31 residues), 21.5 bits, see alignment (E = 1e-07) amino acids 76 to 109 (34 residues), 18.5 bits, see alignment 9.5e-07 amino acids 146 to 177 (32 residues), 15 bits, see alignment (E = 1.2e-05) PF13432: TPR_16" amino acids 48 to 109 (62 residues), 25.8 bits, see alignment E=7.1e-09 amino acids 122 to 177 (56 residues), 16.7 bits, see alignment 5e-06 amino acids 154 to 207 (54 residues), 22 bits, see alignment 1.1e-07 PF13424: TPR_12" amino acids 112 to 175 (64 residues), 30.4 bits, see alignment E=2e-10 PF07719: TPR_2" amino acids 146 to 177 (32 residues), 24 bits, see alignment (E = 1.6e-08) PF13176: TPR_7" amino acids 148 to 177 (30 residues), 16.4 bits, see alignment (E = 4.2e-06) PF13174: TPR_6" amino acids 151 to 177 (27 residues), 13 bits, see alignment (E = 7.6e-05) PF01476: LysM" amino acids 346 to 388 (43 residues), 41 bits, see alignment 8.3e-14

Best Hits

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>MIT1002_02790 photosystem I assembly protein Ycf3 (Alteromonas macleodii MIT1002)
MVAGLRTSLKIGFLSAIIFTSGCVSNSQSGLYGGNFDHEEAAKTRMSLGLTYLQNNNYTQ
AKKNLDKALEFNPRSADVQFAMAYYYQLVGDNLRAEEYYETAIDLAPNNGDIANSYGAFK
CQNGEYEKAKAYFFDAINNRLYANAAQTYENLALCAQSQGKLDEAIGYFQDALKHQPARG
KSLFLLSELYTVSEQWELAESTLRKYERVAKVTPDSLWLAYEIAKGKGDLETAKGYGEMM
MSLFPESELTKRYIMQRESMQNRVVKTVKSTQLNDSETEISANQTNTDGLAQTSSNDKEN
EKSVAQDNDALRQSQSNNTDNAPTATANTPEKAQNTELSVQSDKFHVVKEGENLYRISLL
HNIKMATLQEWNNLENTGAIIAGQTLWLVPPSMQEE