Protein Info for MIT1002_02778 in Alteromonas macleodii MIT1002

Annotation: GMP synthase [glutamine-hydrolyzing]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 10 to 205 (196 residues), 272.5 bits, E=1.4e-85
• PF00117: GATase
  • amino acids 11 to 200 (190 residues), 153 bits, E=2e-48
• PF07722: Peptidase_C26
  • amino acids 75 to 183 (109 residues), 26.2 bits, E=1.7e-09
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 213 to 525 (313 residues), 511.6 bits, E=7.5e-158
• PF02540: NAD_synthase
  • amino acids 216 to 260 (45 residues), 29.3 bits, 1.2e-10
• PF03054: tRNA_Me_trans
  • amino acids 229 to 262 (34 residues), 20.7 bits, see alignment (E = 7.4e-08)
• PF00958: GMP_synt_C
  • amino acids 433 to 524 (92 residues), 144.9 bits, E=1.6e-46

Best Hits

Swiss-Prot: 98% identical to GUAA_ALTMD: GMP synthase [glutamine-hydrolyzing] (guaA) from Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 98% identity to amc:MADE_02972)

MetaCyc: 82% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (525 amino acids)

>MIT1002_02778 GMP synthase [glutamine-hydrolyzing] (Alteromonas macleodii MIT1002)
MTTNIHDQRILILDFGSQYTQLIARRVREIGVYCELWAWDVTEEQIREFNPQGIILSGGP
ESVTEEGSPRAPEYVFEAGVPVLGVCYGMQTMAQQLGGGVLGSDKREFGYAQVEVIKPSP
LLDKIEDAIGDNGAALLDVWMSHGDKVAAIPEGFETIAQTASCPHAAMYNAEKQFYGVQF
HPEVTHTRQGMRLLTHFVMDICKCEKLWTAGAIIDDAIERIKEKVGNEEVILGLSGGVDS
SVTAMLLHRAIGDKLTCVFVDNGLLRLNEADQVMEMFGDHFGLNIIRVDAEERFLDRLKG
IEDPELKRKAIGNEFVRVFDEEAGKRENAKWLAQGTIYPDVIESAGSATGKAHVIKSHHN
VGGLPEDMELGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEIKKEY
CDLLRRADAIFIEELYAADLYQKVSQAFTVFLPVRSVGVMGDARKYDWVVSLRAVETVDF
MTAHWAHLPYDFLGKVSNRIINEIDGISRVVYDISGKPPATIEWE