Protein Info for MIT1002_02760 in Alteromonas macleodii MIT1002

Annotation: ATP-dependent Clp protease proteolytic subunit precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 TIGR00493: ATP-dependent Clp endopeptidase, proteolytic subunit ClpP" amino acids 11 to 200 (190 residues), 354.8 bits, see alignment E=5.5e-111 PF00574: CLP_protease" amino acids 22 to 201 (180 residues), 300.5 bits, see alignment E=2.4e-94

Best Hits

Swiss-Prot: 91% identical to CLPP_PSEA6: ATP-dependent Clp protease proteolytic subunit (clpP) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K01358, ATP-dependent Clp protease, protease subunit [EC: 3.4.21.92] (inferred from 96% identity to alt:ambt_04060)

MetaCyc: 79% identical to ATP-dependent Clp protease proteolytic subunit (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent or cAMP signaling in bacteria (EC 3.4.21.92)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>MIT1002_02760 ATP-dependent Clp protease proteolytic subunit precursor (Alteromonas macleodii MIT1002)
MTNTPFDPMNALVPMVVEQTSKGERSYDIYSRLLKENVIFLVGQVEDHMANLIVAQMLFL
EAENPEKDIFLYINSPGGSVTAGMAIYDTMKFIKPDVSTVCMGQAASMGAFLLSAGAKGK
RYCLPNSRVMIHQPLGGFQGQASDFEIHAKEILSIKEKLNRLMADHTGQDYEKVARDTDR
DNFLSATEAKEYGLVDQVLANRSDVAATK