Protein Info for MIT1002_02727 in Alteromonas macleodii MIT1002

Annotation: NH(3)-dependent NAD(+) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF02540: NAD_synthase" amino acids 22 to 268 (247 residues), 214.4 bits, see alignment E=7e-68 TIGR00552: NAD+ synthetase" amino acids 22 to 274 (253 residues), 227.4 bits, see alignment E=8.2e-72

Best Hits

Swiss-Prot: 68% identical to NADE_VIBCB: NH(3)-dependent NAD(+) synthetase (nadE) from Vibrio campbellii (strain ATCC BAA-1116 / BB120)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 96% identity to amc:MADE_03015)

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>MIT1002_02727 NH(3)-dependent NAD(+) synthetase (Alteromonas macleodii MIT1002)
MQKQAVIDEMKVLPEIDVEYEVARRVSFIKKQLLTSGLNSLVLGISGGIDSCTLGRLAQL
AVNELNDEHHEKYQFIAVRLPYDTQADEDDAQKSIDFIQPSHSLAVNVKPGADAIHASTS
QALASANLLPDNEAKQDFVKGNVKARTRMVIQYEIAGMVDGLVLGTDHSAENITGFYTKY
GDGACDLAPLFGLSKRQVRAVAAHLGAPHNVITKAPTADLESLSPQKADEQALGMSYDQI
DDFLEGKPVSAEVEEKLLYIYERTQHKRVPIPTIYDEL