Protein Info for MIT1002_02723 in Alteromonas macleodii MIT1002

Annotation: Antitoxin CptB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 83 PF03937: Sdh5" amino acids 8 to 79 (72 residues), 92.7 bits, see alignment E=5.5e-31

Best Hits

Swiss-Prot: 74% identical to SDHE_COLP3: FAD assembly factor SdhE (sdhE) from Colwellia psychrerythraea (strain 34H / ATCC BAA-681)

KEGG orthology group: K09159, hypothetical protein (inferred from 87% identity to alt:ambt_04235)

Predicted SEED Role

"YgfY COG2938"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (83 amino acids)

>MIT1002_02723 Antitoxin CptB (Alteromonas macleodii MIT1002)
MFEPKRLARLKWACRRGMLELDVLLLPFVEEAFDSLSYEDQETFERLLTSDDPDLFAWIM
GHQKCEDPELAAMVATIVNRVKV