Protein Info for MIT1002_02720 in Alteromonas macleodii MIT1002

Annotation: L-aspartate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 TIGR00551: L-aspartate oxidase" amino acids 18 to 526 (509 residues), 686.2 bits, see alignment E=1.2e-210 PF01266: DAO" amino acids 20 to 142 (123 residues), 29.6 bits, see alignment E=1.4e-10 PF00890: FAD_binding_2" amino acids 20 to 398 (379 residues), 339.2 bits, see alignment E=1.1e-104 PF02910: Succ_DH_flav_C" amino acids 447 to 531 (85 residues), 59.2 bits, see alignment E=1.1e-19

Best Hits

Swiss-Prot: 73% identical to NADB_VIBCH: L-aspartate oxidase (nadB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K00278, L-aspartate oxidase [EC: 1.4.3.16] (inferred from 97% identity to amc:MADE_03007)

MetaCyc: 71% identical to L-aspartate oxidase (Escherichia coli K-12 substr. MG1655)
1.5.98.-; L-aspartate oxidase. [EC: 1.4.3.16]

Predicted SEED Role

"L-aspartate oxidase (EC 1.4.3.16)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 1.4.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>MIT1002_02720 L-aspartate oxidase (Alteromonas macleodii MIT1002)
MKSVSSSLTSTSNAIEHRCDVLIIGSGAAGLSLALKLADHCQVIVLSKSDRNEGSTRYAQ
GGIAAVFDEQDSIDAHVKDTLAAGAGLCEEPAVRFTAERAKASLEWLISYGVPFDTEKSE
SGEERFHLTREGGHSHRRILHAADATGEALQITLNDAVSTHPNIHIFERYNAIDLIPSKE
EKNSVVGAYVWNRQQEHVEVIRAPFVALATGGGSKVYQYTSNPDVSSGDGIAMAWRAGCR
VANMEFNQFHPTCLFHPQARNFLITEALRGEGANLCHADGTRFMHKFDERGDLAPRDVVA
RAIDYEMKRLGADCMYLDISHKPADFIVKHFPNIYRKCRSLGIDITREPIPVVPAAHYSC
GGVMTDFNAKTDLNNVYAIGEVAYTGLHGANRMASNSLLECVVFASAAAEDIIKNLPSAD
CEESIAPWDESQVSNSDEEVIIQHNWHELRLFMWDYVGIVRTDKRLERAMRRIKLLEQEI
TEYYSHFRVSNNLLELRNLVTVAELIVRCAMERKESRGLHFNLDYPEQLDNPVPTILIPR
KQLSGADVGSLITQDSFADAD