Protein Info for MIT1002_02690 in Alteromonas macleodii MIT1002

Annotation: Chemotaxis protein PomA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 35 to 58 (24 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 178 to 202 (25 residues), see Phobius details PF01618: MotA_ExbB" amino acids 98 to 211 (114 residues), 100.5 bits, see alignment E=3e-33

Best Hits

Swiss-Prot: 68% identical to POMA_VIBAL: Chemotaxis protein PomA (pomA) from Vibrio alginolyticus

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 96% identity to amc:MADE_01428)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>MIT1002_02690 Chemotaxis protein PomA (Alteromonas macleodii MIT1002)
MDLATVIGMLGAIGFIVMAMILGGSLGMFIDVQSILIVFGGTLFVVLSQFTLGQFFSAGK
VAGKAFMFKIETPEELIEKIVEMADAARKGGFLALEEAEISNEFMQKGVDMLVDGHDIEV
VRETLAKDISMTTERHEFGASIFKGMGDVAPAMGMIGTLIGLVAMLSNMDDPKAIGPAMA
VALLTTLYGAFFANVVCLPIAFKLAVRAGEEKLNQSLVLDGIVGIADGQNPRVIEGVLKN
YLAASKRGSAEEE