Protein Info for MIT1002_02688 in Alteromonas macleodii MIT1002

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF02353: CMAS" amino acids 133 to 403 (271 residues), 285.3 bits, see alignment E=1.2e-88 PF13489: Methyltransf_23" amino acids 190 to 302 (113 residues), 32.6 bits, see alignment E=1.7e-11 PF08241: Methyltransf_11" amino acids 197 to 293 (97 residues), 33.4 bits, see alignment E=1.4e-11 PF13649: Methyltransf_25" amino acids 197 to 290 (94 residues), 40.4 bits, see alignment E=9.6e-14

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 91% identity to amc:MADE_01431)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79), plant type" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>MIT1002_02688 Cyclopropane-fatty-acyl-phospholipid synthase (Alteromonas macleodii MIT1002)
MSFGESVLLTTSEVSFVDKACRTLFLQCLKQLPFGSLTIQENGDVVARFGTDESDLRATV
NIKDVQAYRRLLLGGSVGAGEAFMDGLWDSDDVTAVVRVFARNLSTLDEWENKFKWVTMP
INKIQHFARRNTKDQAKKNIEAHYDLGNKLYTRFLDPTMMYSSAIYPDPNATLNDAQNYK
LKAICDKLQLSETDHLLEIGTGWGGLAVYAAKHYGCRVTTTTISEEQHAWAKEWIAREEL
ESKITLLKKDYRLLEGKYDKLVSIEMIEAVGKQFLRNFFEKCSSLLKDDGLMLLQSITID
DRRYDSYSNSVDFIQKYIFPGGFLPSQHQLNAHLKKYTNMMIRDLHDIGIDYAKTLNHWY
EAFISAKDELLNDGYDERFMRMWTYYLKYCEGGFLERTISTVQLVISKPHYRLDLARV