Protein Info for MIT1002_02677 in Alteromonas macleodii MIT1002

Annotation: Heat shock protein F84.1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 858 PF02861: Clp_N" amino acids 5 to 128 (124 residues), 116.6 bits, see alignment E=5.8e-37 TIGR03346: ATP-dependent chaperone protein ClpB" amino acids 6 to 853 (848 residues), 1448.1 bits, see alignment E=0 PF23569: NBD_SMAX1" amino acids 185 to 285 (101 residues), 30.6 bits, see alignment E=2e-10 PF00004: AAA" amino acids 203 to 320 (118 residues), 47.2 bits, see alignment E=2e-15 amino acids 602 to 723 (122 residues), 39.7 bits, see alignment E=4.3e-13 PF17871: AAA_lid_9" amino acids 342 to 443 (102 residues), 117.6 bits, see alignment E=1.5e-37 PF07724: AAA_2" amino acids 596 to 760 (165 residues), 239.2 bits, see alignment E=1.6e-74 PF00158: Sigma54_activat" amino acids 600 to 724 (125 residues), 23 bits, see alignment E=3.6e-08 PF07728: AAA_5" amino acids 601 to 722 (122 residues), 48.8 bits, see alignment E=5e-16 PF10431: ClpB_D2-small" amino acids 766 to 846 (81 residues), 91 bits, see alignment E=2.6e-29

Best Hits

Swiss-Prot: 77% identical to CLPB_VIBCH: Chaperone protein ClpB (clpB) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03695, ATP-dependent Clp protease ATP-binding subunit ClpB (inferred from 99% identity to amc:MADE_01442)

MetaCyc: 75% identical to protein disaggregase ClpB (Escherichia coli K-12 substr. MG1655)
RXN185E-10

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (858 amino acids)

>MIT1002_02677 Heat shock protein F84.1 (Alteromonas macleodii MIT1002)
MRLDRFTSKFQLAISDAQSLALGRDHQYIEPVHLMTAMLNQQGGSVRPLLDQANINVNAL
RSALSQAIERLPRIEGIGGDVQLSKDSGILLNLCDKIAQQRKDEYITSEIFVLAALQDKG
RLGEILKSLNITKEAIESAIDDMRGGQKVTDPNAEDVRQALEKYTTDLTERAEQGKLDPV
IGRDDEIRRTVQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKNKRVLAL
DMGALVAGAKYRGEFEERLKAVLNELAKEEGRVILFVDELHTMVGAGKGDGAMDAGNMLK
PALARGELHCVGATTLDEYRQYIEKDAALERRFQKVLVEEPSVEDTIAILRGLKERYELH
HSVDITDPAIVAAASLSHRYISDRQLPDKAIDLIDEAASSIRLQIDSKPEEMDRLERRII
QLKLEEQALAKETDDASHKRLEMIELEREQAETKYAELEKVWLDEKDAMQGTQSIKGELE
QAKLDLEIARRASDLNRMSELQYGRIPELEAKLEQAAENETRETTLLKNKVTDVEIADVL
SRWTGIPVARMLEGEREKLLRMEDVLHKRVVGQEEAVEAVSNAIRRSRAGLADPNRPIGS
FLFLGPTGVGKTELCKALAGFMFDTEDAMVRIDMSEFMEKHSVARLVGAPPGYVGYEEGG
YLTEAVRRKPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFKNTVVIMTSNL
GSDIIQDKHNESQYDDMKASVMSVVGQHFRPEFINRVDDIVVFHPLGKEQIKSIAKIQLA
SLRARLAEKGYKLTLSAAAMDKLADAGFDPVFGARPLKRAIQVQVENPLAHQLLAGELIP
ESTIRIDADDSGLFVVSN