Protein Info for MIT1002_02673 in Alteromonas macleodii MIT1002

Annotation: L-lactate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 58 to 82 (25 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 369 to 387 (19 residues), see Phobius details amino acids 408 to 427 (20 residues), see Phobius details amino acids 451 to 473 (23 residues), see Phobius details amino acids 487 to 528 (42 residues), see Phobius details amino acids 541 to 559 (19 residues), see Phobius details TIGR00795: transporter, lactate permease (LctP) family" amino acids 8 to 557 (550 residues), 355.6 bits, see alignment E=2.6e-110 PF02652: Lactate_perm" amino acids 8 to 554 (547 residues), 364.8 bits, see alignment E=4.2e-113

Best Hits

KEGG orthology group: K03303, lactate transporter, LctP family (inferred from 66% identity to vcj:VCD_000355)

Predicted SEED Role

"L-lactate permease" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (569 amino acids)

>MIT1002_02673 L-lactate permease (Alteromonas macleodii MIT1002)
MNEITLGLLALLPITLSAVLLLGLQWSAKRAMPVVLASTALMALLAWDMSAVRVGASILQ
GLVITVSVLWIVFGAIFLLNTLKYTGAIDVIRQGFTNISPDRRVQAIIIAWCFGTFIEGA
SGFGTPAAIAAPLLVAIGFPALAAVLIGMMIQSTPVSFGAVGTPIVIGVNKGLDGQAISQ
TLQAQGWQWEQFIQLITSEVATIHGIIGSFMPVLMAVMLTRFFGSNKSWREGLQILPFAL
FAGVSFTIPYVFTGIVLGPEFPSLIGGLVSLAVVVTAAKNGFLMPKTTWDFPPKASWDKG
WLGNLEIKADDITSQKAMHWVTAWVPYLVVALLLVISRVFPTIKEFTTSLTLSFDNILGE
TGVSASISPLYLPGGLLLIGALVAVIIQSKKVSKGEVLFKAFNDSSKTLLSAGFVLMFTI
PMVRLFINSGVNGADIVSMPIAGAQLFANMFGEAFPLISPTIGALGAFIAGSNTVSNMMF
SQFQFEAALSLQLSPALIIAAQAVGAAAGNMIAIHNVVAASATVGLMGQEGATLRKTVIP
TIYYVAFAGILVWLGVYVFDVGGPLVGTN