Protein Info for MIT1002_02668 in Alteromonas macleodii MIT1002

Annotation: CDP-diacylglycerol-serine O-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 35 to 52 (18 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 193 to 223 (31 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 11 to 122 (112 residues), 80.5 bits, see alignment E=8.8e-27 TIGR00473: CDP-diacylglycerol-serine O-phosphatidyltransferase" amino acids 19 to 179 (161 residues), 126.8 bits, see alignment E=4e-41

Best Hits

KEGG orthology group: K00998, phosphatidylserine synthase [EC: 2.7.8.8] (inferred from 94% identity to amc:MADE_01448)

Predicted SEED Role

"CDP-diacylglycerol--serine O-phosphatidyltransferase (EC 2.7.8.8)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>MIT1002_02668 CDP-diacylglycerol-serine O-phosphatidyltransferase (Alteromonas macleodii MIT1002)
MSDQKRKGIYLLPNLLTTAGLFSGFFAVVSSMNGRFEAAAVAIFVAMIFDGLDGRVARMT
NTQSDFGAEFDSMADMVSFGVAPALVAYNWGLTELGKLGWLAAFIYVAGAALRLARFNTQ
VGIADKRFFQGLASPAAAAVVSGLVWVGVEYDAVGTDYGFIVAAVTGLAGLLMVSNFKYN
SFKEVNWHGKVPFVGLLLVLLIFVVVATEPALVLFLVFALYALAGPINTFRTVEKVTLDD
VVGDHEEDADFNADKKKSNESVDNKQE