Protein Info for MIT1002_02649 in Alteromonas macleodii MIT1002

Annotation: Recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00615: recombination protein RecR" amino acids 2 to 197 (196 residues), 254.1 bits, see alignment E=3.6e-80 PF21176: RecR_HhH" amino acids 8 to 51 (44 residues), 76 bits, see alignment 3.8e-25 PF02132: RecR_ZnF" amino acids 54 to 73 (20 residues), 32.4 bits, see alignment (E = 1.5e-11) PF13662: Toprim_4" amino acids 82 to 172 (91 residues), 93.8 bits, see alignment E=1.5e-30 PF01751: Toprim" amino acids 83 to 167 (85 residues), 54.5 bits, see alignment E=2.8e-18 PF21175: RecR_C" amino acids 174 to 197 (24 residues), 53.4 bits, see alignment (E = 3.6e-18)

Best Hits

Swiss-Prot: 72% identical to RECR_PSEA6: Recombination protein RecR (recR) from Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)

KEGG orthology group: K06187, recombination protein RecR (inferred from 95% identity to alt:ambt_04580)

MetaCyc: 64% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>MIT1002_02649 Recombination protein RecR (Alteromonas macleodii MIT1002)
MKFSPLLSELIQALTCLPGVGNKSAQRMAFHLLERNRTGAIDLSNVLHNAMEHIHHCKRC
RTFTEDELCDICRHPEREASGLLCIVESPQDVLAIEQTLSYKGQYFVLMGHLSPIDGVGP
EEIGLTELEARLAAGGINEVILATNPTVEGEATAHYIAQLCASHNVDASRIAHGVPVGGE
LEYIDGNTLTHAFSGRRKL