Protein Info for MIT1002_02555 in Alteromonas macleodii MIT1002

Annotation: Isochorismatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 PF00857: Isochorismatase" amino acids 11 to 161 (151 residues), 75.1 bits, see alignment E=3.9e-25

Best Hits

KEGG orthology group: None (inferred from 45% identity to dps:DP1719)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 3.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.3.2.1

Use Curated BLAST to search for 3.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (186 amino acids)

>MIT1002_02555 Isochorismatase family protein (Alteromonas macleodii MIT1002)
MMHLNEEKVGLLIVDVQGALARKVNDSQTMICKTVKLIQCCKLLNIPVVVLEQNPDGLGR
TVPEIETHVASDPHFKKFTFNAVAGTDQCSSEILAYIGEMELSRWLVVGIEAHVCVYQTV
TGLLENNHTVEVIQDCISSRESSNAVLAIQNMREQGARISSFEMTLFGLLKSCQHPKFRE
VLALIK