Protein Info for MIT1002_02533 in Alteromonas macleodii MIT1002

Annotation: L-fuculose phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00596: Aldolase_II" amino acids 19 to 198 (180 residues), 158.8 bits, see alignment E=7e-51

Best Hits

Swiss-Prot: 64% identical to Y3430_PSEAE: Putative aldolase class 2 protein PA3430 (PA3430) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to amc:MADE_01199)

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>MIT1002_02533 L-fuculose phosphate aldolase (Alteromonas macleodii MIT1002)
MTDSVKSKVSSEEWQTRVDLAACYRAVAMYGWDDLIFTHISARVPGPDHHFLINPYGLMF
DEVTASSLVKVDLHGNKVMESEYDINPAGFTIHSAVHEARDDAKCVLHLHTAEGVAVSIL
EEGLQPYSQQSLFPLASLSYHAYEGVALNPEEKVRLVRDLGDTQFMILRNHGLLTCADNI
PDAFLFMFIMQRACEIQLKAQATGKPLIPIHSAILDGIRTQADQVTRQAGGSLAWPGIKR
RVERRFPGYDK