Protein Info for MIT1002_02525 in Alteromonas macleodii MIT1002

Annotation: Pur regulon 18 kDa protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details PF02674: Colicin_V" amino acids 4 to 141 (138 residues), 116.4 bits, see alignment E=5.4e-38

Best Hits

Swiss-Prot: 61% identical to CVPA_HAEIN: Colicin V production protein homolog (cvpA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03558, membrane protein required for colicin V production (inferred from 88% identity to alt:ambt_05080)

Predicted SEED Role

"Colicin V production protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>MIT1002_02525 Pur regulon 18 kDa protein (Alteromonas macleodii MIT1002)
MNWVDFSILGIIAVSTLISLIRGFVKEAISLVVWFAALFISSNFYADLAVYFTAIDDPYL
KNGAAIAALFVTTLILGGMINYVISQLVQATGLSGTDRALGIVFGALRGVLIVSALLFFM
DTFTGAASSDWWQASVLIPEFGVIIEWFFSYVKDSSSFLNPA