Protein Info for MIT1002_02521 in Alteromonas macleodii MIT1002

Annotation: Inner membrane protein YohC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 164 to 191 (28 residues), see Phobius details PF04893: Yip1" amino acids 7 to 181 (175 residues), 123.9 bits, see alignment E=3.3e-40

Best Hits

KEGG orthology group: None (inferred from 96% identity to amc:MADE_01961)

Predicted SEED Role

"FIG01345364: inner membrane protein Yip1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>MIT1002_02521 Inner membrane protein YohC (Alteromonas macleodii MIT1002)
MILNHLIGIYTHPKEEWQTIDTKHETYFYALTHIAFISLIPSLVAYYSSAHTGWSIGAGD
IIRLSENTAIMMGIGMYFGLIAGVVALAVLIHELAKAFDATPTYTQSLELAAYTATPLFM
VGFAGLYPELWVVMTALLVGISYSVYLLYSGVPILMHMPEDKGFIYSSSVVTCGLVLLVI
LMTGSVLVWGLSGGPVFVH