Protein Info for MIT1002_02490 in Alteromonas macleodii MIT1002

Annotation: Flagellum site-determining protein YlxH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF10609: ParA" amino acids 95 to 339 (245 residues), 330.1 bits, see alignment E=2e-102 PF13614: AAA_31" amino acids 98 to 135 (38 residues), 40 bits, see alignment 1e-13 PF09140: MipZ" amino acids 99 to 237 (139 residues), 37.3 bits, see alignment E=5e-13 PF01656: CbiA" amino acids 100 to 314 (215 residues), 48.9 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 92% identity to amc:MADE_01985)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>MIT1002_02490 Flagellum site-determining protein YlxH (Alteromonas macleodii MIT1002)
MFFSRKAEPATQKVAVILAKYFSLDVEDTLPWCAFSKPENEDAGVTITLPFCIATQLDAL
KQEVLKQLKGKLGDDQLTFKQSVASGETEVAPVTNIKNIIAVASGKGGVGKSTTSINLAF
ALMQEGAKVGILDADIYGPSIPIMLGNPDAHPESEDNKHMQPLMSHGLVANSIGYLVPQE
DAAVWRGPMASRALKQLLDETLWPVLDYLIVDMPPGTGDIQLTMAQQVPLTASVVVTTPQ
DLALADAQKGISMFEKVNVPVLGLIENMSYYQCRACGTKDYVFSKDGGEALAERHGLPLL
GQLPLDIHIREHGDAGTPLLITSPESALSESYREAARALSMQLALTVAPRKGAVKHIKGN
PIGIVGKE