Protein Info for MIT1002_02450 in Alteromonas macleodii MIT1002

Annotation: Signal transduction histidine-protein kinase BarA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 PF00512: HisKA" amino acids 32 to 95 (64 residues), 61.6 bits, see alignment E=8.9e-21 PF02518: HATPase_c" amino acids 142 to 254 (113 residues), 92.9 bits, see alignment E=2.8e-30 PF00072: Response_reg" amino acids 275 to 380 (106 residues), 43.4 bits, see alignment E=5.1e-15 amino acids 406 to 515 (110 residues), 91.9 bits, see alignment E=4.5e-30

Best Hits

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (521 amino acids)

>MIT1002_02450 Signal transduction histidine-protein kinase BarA (Alteromonas macleodii MIT1002)
MERTVKRSFAKLTSLKEQAESSADEARRASKAKSEFLSSMSHELRTPMNGLFGMIELAID
NPDKRNIYLRKAETAGRQLLVLINDILDISKIEAGKIKIEQAPVDLLQVLDDVVSLQRVY
CHRKGLEFHYLKDPDLPHVIKGDITRISQILHNLLSNAIKFTEQGSVTLKVTYTKRPNGN
YLSFDVIDTGIGIESSKLDNIFKKFEQADQSTTREYGGTELGLSIAKQLAKLMLGDINVT
SFVGQGSTFSFTMAAEESQLPDINVEPSANLRCAIVDDLQTSREYFEHVVTSMSIVPQSY
DSAKAYLSDSPLAFDVIILDLSMPEMSGVDLLEQLKAMNPDKFPKIILISAELERLEDEN
DVSELIWRTHAKPINRRELEHDLGRLIETKPVSHNDVKEGNKKKRILLAEDNEINAEIVK
TILQSEGYKFLHVKNGKDAVDVGKRHQFDLILMDCNMPVMGGIEASTILRKALEVDTPIV
ALTANAFAEDKEECLAAGMTDFLAKPLDKDTLLVCIKKYIG