Protein Info for MIT1002_02407 in Alteromonas macleodii MIT1002

Annotation: Glucose-6-phosphate 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 9 to 490 (482 residues), 617.8 bits, E=6.9e-190
• PF00479: G6PD_N
  • amino acids 13 to 185 (173 residues), 185 bits, E=2.3e-58
• PF02781: G6PD_C
  • amino acids 188 to 488 (301 residues), 417.1 bits, E=3.5e-129

Best Hits

Swiss-Prot: 61% identical to G6PD_DICD3: Glucose-6-phosphate 1-dehydrogenase (zwf) from Dickeya dadantii (strain 3937)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 98% identity to amc:MADE_01244)

MetaCyc: 60% identical to NADP+-dependent glucose-6-phosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Glucose-6-phosphate dehydrogenase. [EC: 1.1.1.49]

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (16/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• heterolactic fermentation (15/18 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• L-lysine biosynthesis II (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
• formaldehyde oxidation I (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Protein Sequence (497 amino acids)

>MIT1002_02407 Glucose-6-phosphate 1-dehydrogenase (Alteromonas macleodii MIT1002)
MVLDNSYEPCDFVLFGTLGDLSRRKLLPSLYQLEKANLMHPDTTIVGVARQEMELDAYIE
EVHANLIKFGEKNLCEATWEKMKARLHYACVDMKDVESYCVLDDHVDSSRTMVCYLATPP
AIYGDICRGLHSCKIIDSSVRVVLEKPIGHDLASSKVINEQVAEYFDEKQIYRIDHYLGK
ETVLNLVSLRFANSIFATNWDHNCIDHVQISVAESVGIEGRWGYFDDAGQMRDMVQNHLL
QILSLVAMEPPTTLDADSIRDEKLKVLKALRPINSFNINESTVRGQYTSGFVKGEEVPGY
LEEEGANTQSKTETFVAIKAEIDNWRWAGVPFYLRTGKRMPTKVSEVVIYFKRQPHNLFG
DSFKNLPPNKLVIRLQPDEGVEITVMNKVPGLTSSGSMDLQKSKLNLSFSEAFADERIPD
AYEKLLLEVMLGNQALFVRRDEIEQAWTWVDSILEAWKQSSEPPEPYQAGTWGPVDSIGL
LARENRSWYESKTGKKK